DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and dlx4a

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_571375.1 Gene:dlx4a / 30561 ZFINID:ZDB-GENE-980526-73 Length:250 Species:Danio rerio


Alignment Length:143 Identity:47/143 - (32%)
Similarity:72/143 - (50%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 LHGGHQHPH-PHQAGFAAVAAAVGAAPSALQSLQQLHQQHH-------AQQQATLSFQREKLKSD 307
            :||.||..| .:.|.|:.     |||..:..........||       .|..:.:.:.|.: .:|
Zfish    44 VHGLHQGAHSQYDAAFSP-----GAASYSRPLAYHYSTAHHHPGAYLPYQHNSAVGYSRVE-DAD 102

  Fly   308 SHKKSAL---------KNKRV---RTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQV 360
            |.|:|::         |.|::   |||::..||:.|...|::.||:..|||..||..|.||:.||
Zfish   103 SEKQSSIESGEIRLNGKGKKIRKPRTIYSSLQLQALNQRFQQTQYLALPERADLAAKLGLTQTQV 167

  Fly   361 KVWFQNRRIKWRK 373
            |:||||:|.|::|
Zfish   168 KIWFQNKRSKYKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 26/51 (51%)
dlx4aNP_571375.1 COG5576 98..206 CDD:227863 33/84 (39%)
Homeobox 126..179 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..202
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.