DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Cdx4

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001100412.1 Gene:Cdx4 / 302400 RGDID:1561529 Length:288 Species:Rattus norvegicus


Alignment Length:177 Identity:48/177 - (27%)
Similarity:81/177 - (45%) Gaps:24/177 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 NSSPSVNNFNCDSV---AGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQ 292
            :|||:..:.:..::   .|.|...:||..   |..|..:.|:...|.:..|....:..|..:   
  Rat   103 SSSPAFGSPDYSTLGPTGGAGGASNGGSL---PDAASESLVSIDSGTSGGATSPSRSRHSPY--- 161

  Fly   293 QQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTE 357
                 ::.|:.::...  |:..|.| .|.::|..|...||.||...:|:....:..||..|.|:|
  Rat   162 -----AWMRKTVQVTG--KTRTKEK-YRVVYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSE 218

  Fly   358 AQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVS 404
            .|||:||||||.|.||    :.:::   |.|.:..|.|:..:..|:|
  Rat   219 RQVKIWFQNRRAKERK----MIKKK---ISQFENSGGSVQSDSGSIS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 23/51 (45%)
Cdx4NP_001100412.1 Caudal_act 13..166 CDD:398418 13/73 (18%)
Homeobox 181..234 CDD:395001 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.