DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Dlx2

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001178675.1 Gene:Dlx2 / 296499 RGDID:1304853 Length:332 Species:Rattus norvegicus


Alignment Length:366 Identity:90/366 - (24%)
Similarity:124/366 - (33%) Gaps:141/366 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HHQQL---HTHHQDGHHPHPPTPTTGNNNNNSSSSSNSSSHNSNSNHREQ----LAAAAATATSH 152
            |..|:   .|:||   |..||:    .....|..||||||.|||. |:.|    |..:.||.:|:
  Rat    13 HSTQITASSTYHQ---HQQPPS----GAGAGSGGSSNSSSSNSNL-HKPQESPTLPVSTATDSSY 69

  Fly   153 AQLIEAAAAHSSLDVGKSFTIAAILGLQSQRKDYNNAINLSLHDNNNIIGDDNNKCYTSNPNNNN 217
                                                                    ||      |
  Rat    70 --------------------------------------------------------YT------N 72

  Fly   218 NNNNNGGSNSGNNNSSPSVNNFNCDSVAGNGRYLH-GGHQHPHPHQAGFAAV------------- 268
            ..:..||   |...:||               |.| |.:|:   |.:|...|             
  Rat    73 QQHPAGG---GGGGASP---------------YAHMGSYQY---HASGLNNVSYSAKSSYDLGYT 116

  Fly   269 AAAVGAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEA 333
            ||....||....|....::......:..:.....|.|         |.::.|||::..||..|:.
  Rat   117 AAYTSYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPK---------KVRKPRTIYSSFQLAALQR 172

  Fly   334 EFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLG 398
            .|::.||:..|||..||.:|.||:.|||:||||||.|::|      ..:...|...|.||.|...
  Rat   173 RFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKK------MWKSGEIPTEQHPGASASP 231

  Fly   399 NQVS--VSANAAHSVSTERT------------NGCSAASPS 425
            ...|  |||.|:.....::.            .|.|.:|||
  Rat   232 PCASPPVSAPASWDFGAQQRMAGGGPGSGGSGAGSSGSSPS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 27/51 (53%)
Dlx2NP_001178675.1 DLL_N 54..135 CDD:289198 25/163 (15%)
Homeobox 158..211 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.