DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Pitx3

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_062120.1 Gene:Pitx3 / 29609 RGDID:3332 Length:302 Species:Rattus norvegicus


Alignment Length:95 Identity:41/95 - (43%)
Similarity:56/95 - (58%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 QQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAH 351
            |:|...::|:.|......:..|.||   |.:|.||.||.:||:.|||.|:|.:|.....|..:|.
  Rat    36 QEHSDSEKASASLPGGSPEDGSLKK---KQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAV 97

  Fly   352 TLKLTEAQVKVWFQNRRIKWRKHHLELTQQ 381
            ...||||:|:|||:|||.||||.  |.:||
  Rat    98 WTNLTEARVRVWFKNRRAKWRKR--ERSQQ 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 26/51 (51%)
Pitx3NP_062120.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 12/37 (32%)
Homeobox 66..119 CDD:395001 27/52 (52%)
PTZ00395 <142..>236 CDD:185594
OAR 258..275 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275
Nuclear localization signal. /evidence=ECO:0000255 268..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.