DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Dlx3

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001099302.1 Gene:Dlx3 / 287638 RGDID:1304875 Length:287 Species:Rattus norvegicus


Alignment Length:228 Identity:56/228 - (24%)
Similarity:96/228 - (42%) Gaps:57/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 NNFNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQR 301
            :.||.:.:||.|.|                        :|.:..:....::|:.|.::..|..|.
  Rat    67 HQFNLNGLAGTGAY------------------------SPKSEYTYGGSYRQYGAYREQPLPAQD 107

  Fly   302 E-KLKSDSHKKSALKN------KRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQ 359
            . .:|.:...:..:.|      ::.|||::..||..|:..|::.||:..|||..||..|.||:.|
  Rat   108 PVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQ 172

  Fly   360 VKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVSAN----------AAHSVSTE 414
            ||:||||||.|::|           |.:..::|......|..|::.|          ::||....
  Rat   173 VKIWFQNRRSKFKK-----------LYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAP 226

  Fly   415 RTNGCS-----AASPSLQEEDNEDSKHSLSLSG 442
            ..|...     :|||:..::......|:.:|||
  Rat   227 TRNPLPPPLPYSASPNYLDDPTNSWYHTQNLSG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 27/51 (53%)
Dlx3NP_001099302.1 DLL_N 27..107 CDD:403572 10/63 (16%)
COG5576 <109..230 CDD:227863 37/131 (28%)
Homeobox 132..186 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.