DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Gbx1

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_056554.1 Gene:Gbx1 / 231044 MGIID:95667 Length:418 Species:Mus musculus


Alignment Length:59 Identity:33/59 - (55%)
Similarity:43/59 - (72%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 KNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRK 373
            |::|.||.||.|||..||.||..::|:...||..:||.|||:|.|||:||||||.||::
Mouse   315 KSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 32/55 (58%)
Gbx1NP_056554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..320 2/4 (50%)
Homeodomain 317..373 CDD:459649 32/55 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.