DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Vax1

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:265 Identity:74/265 - (27%)
Similarity:105/265 - (39%) Gaps:64/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 PSVNNFNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLS 298
            |...:..|.|.....|.....|:...       .:..|.|:.|:|.     |.:...|...:..|
Mouse     5 PDKMDVRCHSDTEAARVSKNAHKESR-------EIKGAEGSLPAAF-----LKEPQGAFSGSGAS 57

  Fly   299 FQREKLKSDS-------------HKKSALKN------------KRVRTIFTPEQLECLEAEFERQ 338
            ....|.||:|             ..|.:::.            ||.||.||.|||..||.||:|.
Mouse    58 EDCNKSKSNSSADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRC 122

  Fly   339 QYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQR------------LALIRQTQL 391
            ||:||.||..||..|.|:|.||||||||||.|.:|...:.::.|            |.|:.|.:|
Mouse   123 QYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQGRL 187

  Fly   392 ---PG---------TSLLGNQV---SVSANAAHSVSTERTNGCSAASPSLQEEDNEDSKHSLSLS 441
               ||         |..||:.:   |:.|..|.:.:.......:||:.:........|:|..::.
Mouse   188 LSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAAATAPGPAGAASQHQPAVG 252

  Fly   442 GALPP 446
            ||..|
Mouse   253 GAPGP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 34/51 (67%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 16/75 (21%)
Homeobox 103..156 CDD:306543 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.