DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and ceh-5

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_492586.2 Gene:ceh-5 / 191616 WormBaseID:WBGene00000430 Length:134 Species:Caenorhabditis elegans


Alignment Length:72 Identity:35/72 - (48%)
Similarity:43/72 - (59%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 EKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQN 366
            ||:.....|....:.||.||:||.||||.||..|....|:.|..|..||.:|.|::.||||||||
 Worm    21 EKMLEIPAKLDLERPKRPRTVFTDEQLEKLEESFNTSGYLSGSTRAKLAESLGLSDNQVKVWFQN 85

  Fly   367 RRIKWRK 373
            ||.|.:|
 Worm    86 RRTKQKK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 31/55 (56%)
ceh-5NP_492586.2 Homeodomain 36..92 CDD:459649 31/55 (56%)

Return to query results.
Submit another query.