DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and ceh-5

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_492586.2 Gene:ceh-5 / 191616 WormBaseID:WBGene00000430 Length:134 Species:Caenorhabditis elegans


Alignment Length:72 Identity:35/72 - (48%)
Similarity:43/72 - (59%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 EKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQN 366
            ||:.....|....:.||.||:||.||||.||..|....|:.|..|..||.:|.|::.||||||||
 Worm    21 EKMLEIPAKLDLERPKRPRTVFTDEQLEKLEESFNTSGYLSGSTRAKLAESLGLSDNQVKVWFQN 85

  Fly   367 RRIKWRK 373
            ||.|.:|
 Worm    86 RRTKQKK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 29/51 (57%)
ceh-5NP_492586.2 Homeobox 38..91 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159818
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.