powered by:
Protein Alignment CG18599 and ceh-5
DIOPT Version :9
Sequence 1: | NP_650701.1 |
Gene: | CG18599 / 42191 |
FlyBaseID: | FBgn0038592 |
Length: | 475 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492586.2 |
Gene: | ceh-5 / 191616 |
WormBaseID: | WBGene00000430 |
Length: | 134 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 35/72 - (48%) |
Similarity: | 43/72 - (59%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 EKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQN 366
||:.....|....:.||.||:||.||||.||..|....|:.|..|..||.:|.|::.||||||||
Worm 21 EKMLEIPAKLDLERPKRPRTVFTDEQLEKLEESFNTSGYLSGSTRAKLAESLGLSDNQVKVWFQN 85
Fly 367 RRIKWRK 373
||.|.:|
Worm 86 RRTKQKK 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160159818 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0850 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.740 |
|
Return to query results.
Submit another query.