DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Msx3

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_034966.1 Gene:Msx3 / 17703 MGIID:106587 Length:204 Species:Mus musculus


Alignment Length:112 Identity:41/112 - (36%)
Similarity:56/112 - (50%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 HKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRK 373
            ||    .|::.||.||..||..||.:|.::||:...||...:.:|.|||.|||:||||||.| .|
Mouse    84 HK----TNRKPRTPFTTAQLLALERKFHQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAK-AK 143

  Fly   374 HHLELTQQRLALIRQTQLP---------GTSLLGNQVSVSANAAHSV 411
            ...|...::|.|..:..||         ||.|..:..:...||...:
Mouse   144 RLQEAELEKLKLAAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 27/51 (53%)
Msx3NP_034966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..89 3/8 (38%)
Homeobox 90..143 CDD:278475 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.