Sequence 1: | NP_650701.1 | Gene: | CG18599 / 42191 | FlyBaseID: | FBgn0038592 | Length: | 475 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005211.1 | Gene: | DLX3 / 1747 | HGNCID: | 2916 | Length: | 287 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 57/228 - (25%) |
---|---|---|---|
Similarity: | 97/228 - (42%) | Gaps: | 57/228 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 237 NNFNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQR 301
Fly 302 E-KLKSDSHKKSALKN------KRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQ 359
Fly 360 VKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVSANAAHSVSTERTNGCS---- 420
Fly 421 -----------AASPSLQEEDNEDSKHSLSLSG 442 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18599 | NP_650701.1 | Homeobox | 320..372 | CDD:278475 | 27/51 (53%) |
DLX3 | NP_005211.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..39 | ||
DLL_N | 27..107 | CDD:403572 | 10/63 (16%) | ||
COG5576 | <109..232 | CDD:227863 | 38/133 (29%) | ||
homeobox | 129..188 | 28/69 (41%) | |||
Homeobox | 132..186 | CDD:395001 | 27/53 (51%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 195..287 | 14/65 (22%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |