DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and ceh-12

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_491693.1 Gene:ceh-12 / 172255 WormBaseID:WBGene00000436 Length:180 Species:Caenorhabditis elegans


Alignment Length:56 Identity:28/56 - (50%)
Similarity:37/56 - (66%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 KNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIK 370
            |.:|.||.|:.|||..||.:|...:|:..|.|..||..|.|:|.|:|:||||||:|
 Worm   109 KMRRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWFQNRRMK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 27/54 (50%)
ceh-12NP_491693.1 Homeodomain 111..167 CDD:459649 27/54 (50%)

Return to query results.
Submit another query.