DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and NKX6-3

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:238 Identity:71/238 - (29%)
Similarity:88/238 - (36%) Gaps:103/238 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GGSNSGNNNSSPSVNNFNCDSVAGN-------------GRYLHGGHQHPHPHQAGFAAVAAAVGA 274
            ||.:|.....||.|.||   |.|||             |:...||.|               ...
Human    81 GGLSSQGVYYSPQVGNF---SKAGNEYPTRTRNCWADTGQDWRGGRQ---------------CSN 127

  Fly   275 APSALQSLQQLHQQHHAQQQATLSFQREKLKSDS-HKKSALKNKRVRTIFTPEQLECLEAEFERQ 338
            .|..|                          ||| |||     |..|..||..|:..||..||:.
Human   128 TPDPL--------------------------SDSIHKK-----KHTRPTFTGHQIFALEKTFEQT 161

  Fly   339 QYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSV 403
            :|:.||||..||::|.:||:||||||||||.||||        :.||                  
Human   162 KYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK--------KSAL------------------ 200

  Fly   404 SANAAHSVSTERTNGCSAA------SPSLQEEDNEDSKHSLSL 440
                ..|.||.|..|.:.|      :||    :|||.:::..|
Human   201 ----EPSSSTPRAPGGAGAGAGGDRAPS----ENEDDEYNKPL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 29/51 (57%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.