DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Emx2

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus


Alignment Length:191 Identity:67/191 - (35%)
Similarity:81/191 - (42%) Gaps:58/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 NSS---PSVNNFN---CDSVAGNGRYLHGG-----------------HQHPHPHQAGFAAVAAAV 272
            |||   |.:|.|:   ..:.||.|.|.:..                 |..|.||         |:
Mouse    40 NSSPINPFLNGFHSAAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPH---------AL 95

  Fly   273 GAAPSALQSLQQLHQQH--HAQQQATLS----------------FQREKLKSDS---HKKSALKN 316
            .|.|     |...|..|  .|.||...|                ||......:|   |...|.|.
Mouse    96 AAHP-----LPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKP 155

  Fly   317 KRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLE 377
            ||:||.|:|.||..||..||:..|:||.||..|||:|.|||.||||||||||.|:::..||
Mouse   156 KRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 33/51 (65%)
Emx2NP_034262.2 Homeobox 159..212 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.