DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Emx1

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_034261.1 Gene:Emx1 / 13796 MGIID:95387 Length:257 Species:Mus musculus


Alignment Length:216 Identity:71/216 - (32%)
Similarity:88/216 - (40%) Gaps:71/216 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 NNNNGGS-NSGNNNSSP--------------------------SVNNFNCDSVAGNGRYLHGGHQ 256
            :...||| .||...|.|                          .|:.|...:.||.||.|:||.:
Mouse    19 DGGTGGSPGSGGAGSHPLAVAASEEPLRPTALNYPHPSAAETAFVSGFPAAAAAGAGRSLYGGPE 83

  Fly   257 --------HP----HP-HQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATL----------- 297
                    ||    || ||.|.:              |||..|....||.:..|           
Mouse    84 LVFPEAMNHPALTVHPAHQLGSS--------------SLQPPHSFFSAQHRDPLHFYPWVLRNRF 134

  Fly   298 ---SFQREKLKSDS---HKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLT 356
               .||...:..|.   |...|.|.||:||.|:|.||..||..||:..|:||.||..||.:|.|:
Mouse   135 FGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLS 199

  Fly   357 EAQVKVWFQNRRIKWRKHHLE 377
            |.||||||||||.|:::..||
Mouse   200 ETQVKVWFQNRRTKYKRQKLE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 31/51 (61%)
Emx1NP_034261.1 COG5576 108..>218 CDD:227863 45/109 (41%)
Homeobox 163..215 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.