DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Dlx5

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:352 Identity:80/352 - (22%)
Similarity:119/352 - (33%) Gaps:133/352 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 HHPHPPTPTTGNNNNNSSSSSNSSSHNSNSNHREQLAAAAATATSHAQLIEAAAAHSSLDVGKSF 171
            |||...:||.      ..||:..|.:.|           .|.|..|......:|::     ||:.
Mouse    28 HHPSQESPTL------PESSATDSDYYS-----------PAGAAPHGYCSPTSASY-----GKAL 70

  Fly   172 TIAAILGLQSQRKDYNNAINLSLHDNNNIIGDDNNKCYTSNPNNNNNNNNNGGSNSGNNNSSPSV 236
                                                    ||.....:..||             
Mouse    71 ----------------------------------------NPYQYQYHGVNG------------- 82

  Fly   237 NNFNCDSVAG--NGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLSF 299
                  |.||  ...|...|:..|: ||.|     .|....|||.           :|.:..::.
Mouse    83 ------SAAGYPAKAYADYGYASPY-HQYG-----GAYNRVPSAT-----------SQPEKEVAE 124

  Fly   300 QREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWF 364
            ...::.:...||.    ::.|||::..||..|:..|::.||:..|||..||.:|.||:.|||:||
Mouse   125 PEVRMVNGKPKKV----RKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWF 185

  Fly   365 QNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQVSVSANAAHSVSTERTNGC-SAASPSLQE 428
            ||:|.|.:|           :::..::|              ..||.|:.....| |..||::.|
Mouse   186 QNKRSKIKK-----------IMKNGEMP--------------PEHSPSSSDPMACNSPQSPAVWE 225

  Fly   429 EDNEDSKHSLS-LSGALPPLSRAQSES 454
            .  :.|..||| ...|.||.|.....|
Mouse   226 P--QGSSRSLSHHPHAHPPTSNQSPAS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 26/51 (51%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 8/26 (31%)
DLL_N 32..118 CDD:403572 29/183 (16%)
Homeobox 140..194 CDD:395001 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 18/69 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.