DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and Dlx2

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_034184.1 Gene:Dlx2 / 13392 MGIID:94902 Length:332 Species:Mus musculus


Alignment Length:376 Identity:85/376 - (22%)
Similarity:123/376 - (32%) Gaps:163/376 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HHQQL---HTHHQDGHHPHPPTPT-TGNNNNNSSSSSNSSSHNSNSNHREQLAAAAATATSHAQL 155
            |..|:   .|:||   |..||:.. .|...|::|||||||.|....:  ..|..:.||.:|:   
Mouse    13 HSTQITASSTYHQ---HQQPPSGAGAGPGGNSNSSSSNSSLHKPQES--PTLPVSTATDSSY--- 69

  Fly   156 IEAAAAHSSLDVGKSFTIAAILGLQSQRKDYNNAINLSLHDNNNIIGDDNNKCYTSNPNNNNNNN 220
                                                                 ||      |..:
Mouse    70 -----------------------------------------------------YT------NQQH 75

  Fly   221 NNGGSNSGNNNSSPSVNNFNCDSVAGNGRYLH-GGHQHPHPHQAGFAAV-------------AAA 271
            ..||   |...:||               |.| |.:|:   |.:|...|             ||.
Mouse    76 PAGG---GGGGASP---------------YAHMGSYQY---HASGLNNVSYSAKSSYDLGYTAAY 119

  Fly   272 VGAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFE 336
            ...||....|....::......:..:.....|.|         |.::.|||::..||..|:..|:
Mouse   120 TSYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPK---------KVRKPRTIYSSFQLAALQRRFQ 175

  Fly   337 RQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLPGTSLLGNQV 401
            :.||:..|||..||.:|.||:.|||:||||||.|::|           :.:..::|         
Mouse   176 KTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKK-----------MWKSGEIP--------- 220

  Fly   402 SVSANAAHSVSTERTNGCSAASPSLQEEDNEDSKHSLSLSGALPPLSRAQS 452
                       ||:..|.||:.|.                 |.||:|...|
Mouse   221 -----------TEQHPGASASPPC-----------------ASPPVSAPAS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 27/51 (53%)
Dlx2NP_034184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..83 26/133 (20%)
DLL_N 54..135 CDD:289198 24/165 (15%)
Homeobox 158..211 CDD:278475 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..272 12/62 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.