DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and hoxa9

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_031760007.1 Gene:hoxa9 / 116411596 XenbaseID:XB-GENE-481973 Length:261 Species:Xenopus tropicalis


Alignment Length:65 Identity:28/65 - (43%)
Similarity:35/65 - (53%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 HKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRK 373
            |.:|..|.   |..:|..|...||.||....|:....|..:|..|.|||.|||:||||||:|.:|
 Frog   191 HARSTRKK---RCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 252

  Fly   374  373
             Frog   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 24/55 (44%)
hoxa9XP_031760007.1 Hox9_act 1..182 CDD:461369
Homeodomain 196..252 CDD:459649 25/58 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.