DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and CDX2

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_011533177.1 Gene:CDX2 / 1045 HGNCID:1806 Length:321 Species:Homo sapiens


Alignment Length:300 Identity:81/300 - (27%)
Similarity:111/300 - (37%) Gaps:82/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SSHNSNSNHREQLAAAAATATSHAQ--------LIEAAAAHSSLD----VGKSFTIAAILGLQSQ 182
            |.:.|:..|...|..|.....|..|        :..||||.::||    .|.|:..|....|   
Human    12 SMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPL--- 73

  Fly   183 RKDYNN--------AINLSLHDNNNIIGDDNNKCYTSNPNNNNNNNNNGGS-NSGNNNSSPSVNN 238
            |:|:|.        |.|...|                        ..|||| .:....|||:   
Human    74 REDWNGYAPGGAAAAANAVAH------------------------GLNGGSPAAAMGYSSPA--- 111

  Fly   239 FNCDSVAGNGRYLHGGHQHPHPHQAGFAAVAAAVG------------AAPSALQSLQQLHQQHH- 290
                      .|....|.|.|||... ||.:.|.|            ||.:|.:.|....|:.: 
Human   112 ----------DYHPHHHPHHHPHHPA-AAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNL 165

  Fly   291 ---AQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHT 352
               .::.|..|...:.|.|.|.........:.|.::|..|...||.||...:|:....:..||.|
Human   166 CEWMRKPAQQSLGSQALTSPSSTVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAAT 230

  Fly   353 LKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLP 392
            |.|:|.|||:||||||.|.||.:.:..||:    :|.|.|
Human   231 LGLSERQVKIWFQNRRAKERKINKKKLQQQ----QQQQPP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 24/51 (47%)
CDX2XP_011533177.1 Caudal_act 13..171 CDD:282574 44/198 (22%)
Homeobox 198..250 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.