DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and CDX1

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001795.2 Gene:CDX1 / 1044 HGNCID:1805 Length:265 Species:Homo sapiens


Alignment Length:183 Identity:49/183 - (26%)
Similarity:68/183 - (37%) Gaps:58/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VAGNGRYLHGGHQHPHPHQAGFAAVAAAVGAAPSALQSLQQLHQQHHAQQQATLSFQREKLKSDS 308
            :.|.|.....|.|.|.|::....:|||..|....                               
Human   116 LGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSG------------------------------- 149

  Fly   309 HKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRK 373
              |:..|:| .|.::|..|...||.||...:|:....:..||..|.|||.|||:||||||.|.||
Human   150 --KTRTKDK-YRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERK 211

  Fly   374 HHLELTQQRLALIRQTQLPGTSLLGNQVSVSANAAHSVSTERTNGCSAASPSL 426
            .:.:..||:    :..|.|              .||.::      .:.|.|||
Human   212 VNKKKQQQQ----QPPQPP--------------MAHDIT------ATPAGPSL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 24/51 (47%)
CDX1NP_001795.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 9..153 11/69 (16%)
Caudal_act 13..138 CDD:282574 6/21 (29%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 157..178 7/20 (35%)
Homeobox 158..210 CDD:278475 24/51 (47%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 196..207 8/10 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..265 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.