DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and dlx6

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001135678.1 Gene:dlx6 / 100216239 XenbaseID:XB-GENE-853184 Length:211 Species:Xenopus tropicalis


Alignment Length:166 Identity:36/166 - (21%)
Similarity:64/166 - (38%) Gaps:51/166 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AVSAGQSSYQMEHQQQHHQLQQQQQQQQHHH-----HQQLHTHHQDGHHPHPPTPTTGNNNNNSS 124
            |..:.:|::....|||.|..|........|:     |...|.|    ||||       :..::|.
 Frog    13 AQDSSKSAFMEFGQQQSHSQQSSPVMAAGHYPLHCLHSGSHPH----HHPH-------HQQHDSY 66

  Fly   125 SSSNS----------SSHNSNSNHREQLAAAAATATSHAQLIE--AAAAHSS-----------LD 166
            |.|||          .||:.:|.:.:..::.::::|:....:|  ..|.|.|           |.
 Frog    67 SGSNSYSRSLAAYPYMSHSQHSPYLQSYSSNSSSSTTTQSRVEEPGEAEHYSFSAAPGAPLLLLP 131

  Fly   167 VGKSFTIAAIL------------GLQSQRKDYNNAI 190
            .|:.:|:.:.|            |..||.:.::.|:
 Frog   132 WGRCYTLQSPLQMHLLCGIVTDYGRHSQHRAHDFAL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475
dlx6NP_001135678.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.