DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and hoxa3

DIOPT Version :10

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001120901.1 Gene:hoxa3 / 100151729 XenbaseID:XB-GENE-482267 Length:406 Species:Xenopus tropicalis


Alignment Length:87 Identity:36/87 - (41%)
Similarity:51/87 - (58%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 QQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAH 351
            :|:..||:|..|...|....|........:||.||.:|..||..||.||...:|:..|.|:.:|:
 Frog   135 RQNTKQQKAGSSSSGESCAGDKSPPGQSSSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMAN 199

  Fly   352 TLKLTEAQVKVWFQNRRIKWRK 373
            .|.|||.|:|:||||||:|::|
 Frog   200 LLNLTERQIKIWFQNRRMKYKK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 28/55 (51%)
hoxa3NP_001120901.1 Homeodomain 165..221 CDD:459649 28/55 (51%)
DUF4074 343..404 CDD:463833
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.