DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and dlx1

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001093727.1 Gene:dlx1 / 100101750 XenbaseID:XB-GENE-876850 Length:251 Species:Xenopus tropicalis


Alignment Length:222 Identity:58/222 - (26%)
Similarity:91/222 - (40%) Gaps:66/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 PSALQ----SLQQLHQQHHAQQQATLSFQR----------------------------------- 301
            ||.:.    |:..||.||.:......||.|                                   
 Frog    32 PSPMSHGHYSMHCLHSQHDSSYSGASSFSRALGYPYVNSVSSHSSNPYISTVQSYPNSSSLSQTR 96

  Fly   302 -EKLKSDSHKKSAL---------KNKRV---RTIFTPEQLECLEAEFERQQYMVGPERLYLAHTL 353
             |:..:::.|.:.:         |.|::   |||::..||:.|...|::.||:..|||..||.:|
 Frog    97 LEEPGAETEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASL 161

  Fly   354 KLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQLP-GTSLLGNQVSV----SANAAHSVST 413
            .||:.|||:||||:|.|::|    |.:|..|.:..:.|. |.||..:..||    :.|.....::
 Frog   162 GLTQTQVKIWFQNKRSKFKK----LMKQGGAALESSALANGRSLSSSSPSVAPVWNTNTPSGKTS 222

  Fly   414 ERTNGCSAAS-----PSLQEEDNEDSK 435
            ..|.|....|     ||..:|..:.|:
 Frog   223 SGTPGAYIPSYTSWYPSAHQEAMQQSQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 26/51 (51%)
dlx1NP_001093727.1 Homeobox 127..181 CDD:365835 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.