DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and nkx6-2

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_002937836.1 Gene:nkx6-2 / 100038084 XenbaseID:XB-GENE-484527 Length:281 Species:Xenopus tropicalis


Alignment Length:219 Identity:61/219 - (27%)
Similarity:89/219 - (40%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GSNSGNNNSSPSVNNFNCDSVAGNGRYLHGG--HQHPHPHQAGFAAVAAAVGAA----PSALQSL 282
            ||::...:|.|.:|..    ....|.|.:..  .::|.|       :|...|.|    |..:|..
 Frog    78 GSSANLLSSLPRINGL----ATSTGMYFNPAAVSRYPKP-------LAELPGRAPIFWPGVMQGS 131

  Fly   283 QQLHQQHHAQQQATLSFQREKLKSDSHKKSALKNKRVRTIFTPEQLECLEAEFERQQYMVGPERL 347
            .....:.....||.:...::.           |.|..|..|:.:|:..||..||:.:|:.||||.
 Frog   132 PWRDPRLGCPSQAGMVLDKDG-----------KKKHSRPTFSGQQIFALEKTFEQTKYLAGPERA 185

  Fly   348 YLAHTLKLTEAQVKVWFQNRRIKWRKHH-LELTQQRLALIRQTQLPGTSLLGNQVSVSANAAHSV 411
            .||::|.:||:||||||||||.||||.| .|:                        .:|...|..
 Frog   186 RLAYSLGMTESQVKVWFQNRRTKWRKRHAAEM------------------------ATAKKKHDS 226

  Fly   412 STERTNGCSAASPSLQEEDNEDSK 435
            .||:..     ..|..|||:|.:|
 Frog   227 ETEKMK-----ESSENEEDDEYNK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 28/51 (55%)
nkx6-2XP_002937836.1 Homeobox 157..211 CDD:365835 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.