DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18599 and emx2

DIOPT Version :9

Sequence 1:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001128284.1 Gene:emx2 / 100038069 XenbaseID:XB-GENE-481028 Length:247 Species:Xenopus tropicalis


Alignment Length:237 Identity:72/237 - (30%)
Similarity:98/237 - (41%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 SNSGNNNSSPSVNNFNCDSVAGNGRYLHG--------GHQ-------HPHPHQAGFAAVAAAVGA 274
            :||...|  |.:|.|:   ..|.|.|.:.        .|.       ||.|.....||.......
 Frog    39 ANSAPMN--PFLNGFH---PTGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPTSH 98

  Fly   275 APSALQSLQQ----------LHQQHHAQQQATLSFQREKLKSDS---HKKSALKNKRVRTIFTPE 326
            :|..|.:.||          :|:..:...:    ||.....::|   |...|.|.||:||.|:|.
 Frog    99 SPHPLFASQQRDPSTFYPWLIHRYRYLGHR----FQGNDTSAESFLLHNALARKPKRIRTAFSPS 159

  Fly   327 QLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRKHHLELTQQRLALIRQTQL 391
            ||..||..||:..|:||.||..|||:|.|||.||||||||||.|:::..||..            
 Frog   160 QLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEE------------ 212

  Fly   392 PGTSLLGNQVSVSANAAHSVSTERTNGCSAASPSLQEEDNED 433
                  |:..|.....||.::..|. ....|||...:..::|
 Frog   213 ------GSDSSQKKKGAHHINRWRL-ATKQASPEEIDVTSDD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18599NP_650701.1 Homeobox 320..372 CDD:278475 33/51 (65%)
emx2NP_001128284.1 Homeobox 153..206 CDD:365835 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.