DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and SNX29

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_011521040.1 Gene:SNX29 / 92017 HGNCID:30542 Length:879 Species:Homo sapiens


Alignment Length:458 Identity:82/458 - (17%)
Similarity:162/458 - (35%) Gaps:131/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SPLKKLYVERSLRLQTEDNGCGS--------GGSETGTCAGAIADICDKLDLPY-----DPHDAG 181
            :|||.|:.:..:....  :|.||        |..|.||  |....:.....|.|     .|....
Human   400 APLKVLHNDSDILFPV--SGVGSYSPADAPLGSLENGT--GPEDHVLPDPGLRYSVEASSPGHGS 460

  Fly   182 GITPLDPRCDKEQTNNESQAKETEIELETKQEPKTDVALTKRDYLRLLTPMASIESDDSDYIYEA 246
            .::.|.|.....::...|:.::..:.:..:::...:...:.|:.|                  :.
Human   461 PLSSLLPSASVPESMTISELRQATVAMMNRKDELEEENRSLRNLL------------------DG 507

  Fly   247 ALEFSHAVQAEVNL---EYAEAHERYKHGVDLLLNGAKQDSSEERRFIAKAKIAKYLARAEEIHA 308
            .:|.|.|::.||:.   :.||..||         .|.|..:......:.|.::.||:...:    
Human   508 EMEHSAALRQEVDTLKRKVAEQEER---------QGMKVQALARENEVLKVQLKKYVGAVQ---- 559

  Fly   309 NFLANDCPTKKLQFQLSLDTTDGGSVSHLECPWNQLA-------RYKVLQILQ---------DR- 356
             .|..:..|.::....|:|    |.|:..|....::|       ..|::::.:         :| 
Human   560 -MLKREGQTAEVPNLWSVD----GEVTVAEQKPGEIAEELASSYERKLIEVAEMHGELIEFNERL 619

  Fly   357 ----VMQVQCVTKSQQPAAIMKGVEKPASHSLTQ-----------------------SIFLPQQV 394
                |.:...|::.:|....::|   |....|:|                       |:||..:.
Human   620 HRALVAKEALVSQMRQELIDLRG---PVPGDLSQTSEDQSLSDFEISNRALINVWIPSVFLRGKA 681

  Fly   395 PYMVQLLAYF----QSEQKIFLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAE 455
            .....:...:    ..|..|:  .|..|...|:..||:..| ..::.|    ||    |::....
Human   682 ANAFHVYQVYIRIKDDEWNIY--RRYTEFRSLHHKLQNKYP-QVRAYN----FP----PKKAIGN 735

  Fly   456 EPP------LTSDSDVSDLVRSSQQLLKSVTNTLSNLQAGVVTPKRNKKVDQNRIRS------KP 508
            :||      ..:.|.::.|:.:...|...||:.:::.|......:|.|:: ||.:||      :.
Human   736 KPPPSPAWMTAAASLLASLLPALPPLNLQVTSEVTSSQDAKFVEERRKQL-QNYLRSVMNKVIQM 799

  Fly   509 IPE 511
            :||
Human   800 VPE 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 15/76 (20%)
PKc_like 343..665 CDD:304357 41/229 (18%)
SNX29XP_011521040.1 RUN 54..189 CDD:280855
Ax_dynein_light <487..552 CDD:287215 14/91 (15%)
PX_RUN 668..820 CDD:132810 31/147 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.