DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and RPS6KL1

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_011535508.1 Gene:RPS6KL1 / 83694 HGNCID:20222 Length:603 Species:Homo sapiens


Alignment Length:632 Identity:185/632 - (29%)
Similarity:260/632 - (41%) Gaps:185/632 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 CDKLDLPYDPHDAGGITPLDPRCDKEQTNNESQAKETEIELETKQEPKTDVAL-----TKRDYLR 227
            |:.|..|       |:.| :| |.:.:    |||   .:.||   :.:..|||     |||||| 
Human     6 CECLPSP-------GLEP-EP-CSRAR----SQA---HVYLE---QIRNRVALGVPDMTKRDYL- 50

  Fly   228 LLTPMASIESDDSDYIYEAALEFSHAVQAEVNLEYAEAHERYKHGVDLLLNGAKQDSSEERRFIA 292
                            .:||.:...|::.:|:.:|..|...|::|||:||.|...|.::|||...
Human    51 ----------------VDAATQIRLALERDVSEDYEAAFNHYQNGVDVLLRGIHVDPNKERREAV 99

  Fly   293 KAKIAKYLARAEEIHANFLANDCPTKKLQFQLSLDTTDGGSVSH--------LECPWNQLARYKV 349
            |.||.|||.|||||.      :|   .||..||...:.....|.        |.....||...:|
Human   100 KLKITKYLRRAEEIF------NC---HLQRPLSSGASPSAGFSSLRLRPIRTLSSAVEQLRGCRV 155

  Fly   350 LQILQDR------------VMQVQCVTKSQQPAA----IMKGVEKPASHSLTQS--IFLPQQVPY 396
            :.:::.|            :.|||.|   |.||.    ::|.:  |..|.:::.  ..:|..|||
Human   156 VGVIEKRDLAVLPRLVSNSLPQVQLV---QDPATGGTFVVKSL--PRCHMVSRERLTIIPHGVPY 215

  Fly   397 MVQLLAYFQSEQKIFLLLRQAEGGMLYDYLQS----------------------------YTP-- 431
            |.:||.||.||..|||.|...:||.|:.:|.|                            .||  
Human   216 MTKLLRYFVSEDSIFLHLEHVQGGTLWSHLLSQAHSRHSGLSSGSTQERMKAQLNPHLNLLTPAR 280

  Fly   432 ------------------TSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSDLVRS-SQQLLK 477
                              ||...:..||. ||.:...|.|.|....||.|..|||.:: ...|..
Human   281 LPSGHAPGQDRIALEPPRTSPNLLLAGEA-PSTRPQREAEGEPTARTSTSGSSDLPKAPGGHLHL 344

  Fly   478 SVTNTLSNLQAGVVTPKR----------------NKKVDQNRIRSK-----------PIPEQCLR 515
            .......|..||   |.|                .:.:||:.:.:.           .:.|:.::
Human   345 QARRAGQNSDAG---PPRGLTWVPEGAGPVLGGCGRGMDQSCLSADGAGRGCGRATWSVREEQVK 406

  Fly   516 QWACELAIAIHSLHGKGVILRDLHMGNILLGAKGQLLLTYFYQNEGLTSDDNYVHKALNLEAVAN 580
            |||.|:.:|:.:||.:||:.||||.||:||...|.:.||||    |..|:   |......|||.|
Human   407 QWAAEMLVALEALHEQGVLCRDLHPGNLLLDQAGHIRLTYF----GQWSE---VEPQCCGEAVDN 464

  Fly   581 HFVAPE----RPLTFRSDWWSYGVVLYQLLLGVPYKVTHPGQLDLYGCVQYPSESLEISDHAKDL 641
            .:.|||    ..||...||||:|.:||:||.|:....:||..:..:..:|.|.   .:|..|..|
Human   465 LYSAPEVGGISELTEACDWWSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPE---WLSRPAASL 526

  Fly   642 LEQLLQLSPELRL-----DYDQLQAHPFFKGIDWQ-----AVLEQGT 678
            |.:|||..|..||     ...:|::||||..|.|.     .||..||
Human   527 LTELLQFEPTRRLGMGEGGVSKLKSHPFFSTIQWSKLVGALVLLSGT 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 28/73 (38%)
PKc_like 343..665 CDD:304357 121/424 (29%)
RPS6KL1XP_011535508.1 MIT_SNX15 48..122 CDD:239140 34/99 (34%)
STKc_RPK118_like 148..555 CDD:270728 121/425 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148297
Domainoid 1 1.000 101 1.000 Domainoid score I6947
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I3061
Isobase 1 0.950 - 0 Normalized mean entropy S5007
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D135297at33208
OrthoFinder 1 1.000 - - FOG0007114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15508
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3828
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.