DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx16

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_083344.3 Gene:Snx16 / 74718 MGIID:1921968 Length:344 Species:Mus musculus


Alignment Length:306 Identity:60/306 - (19%)
Similarity:102/306 - (33%) Gaps:94/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DTQEHKGGYTIYKITSIVFPRSVPQALTCLVVWKRFHDVKRLHRELSRRHKSLQLPG-KLPVPTD 79
            :..|.:..:|:|||.....|..      ..||::|:.|..||:.:|..     ..|| :|.:|..
Mouse   116 EVMEERAKFTVYKILVKKSPEE------SWVVFRRYTDFSRLNDKLKE-----MFPGFRLALPPK 169

  Fly    80 STYFKRFDAAVIQRRKEYILQLLDFAAQHPALYKCSTFTQF--FQETPSPNGSPLKKLYVERSLR 142
            ..:...::|..::.|:..:...|.....|..:..|....:|  ..:.|.|..|      :|.|  
Mouse   170 RWFKDNYNAEFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDS------LEES-- 226

  Fly   143 LQTEDNGCGSGGSETGTCAGAIADICDKLDLPYDPHDAGGITPLDPRCDKEQTN----NESQAKE 203
                                  ...|:.|                     |:||    .|...|:
Mouse   227 ----------------------RAFCETL---------------------EETNYHLQRELLEKQ 248

  Fly   204 TEIE----LETKQEPKTDVALTKRDYLRLLTPMASIESDDSDYIYEAALEFSHAVQAE-----VN 259
            .|:|    |..:::...|...|:   :|.|    |:|...|.|:..|  |....::.|     ||
Mouse   249 KEVESLKKLLGEKQLHIDALETR---IRTL----SLEPGASLYVSRA--EGGQILRVEPSVLQVN 304

  Fly   260 LEYAEAHERYKHGVDLLLNGAKQDSSEERRFIAKAKIAKYLARAEE 305
            .:..:...|..|....       :|.|....||..::|:....||:
Mouse   305 RDVLDEESRADHKPHF-------NSREAGSVIAGIEVAQLAYNAED 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 23/110 (21%)
MIT_SNX15 241..315 CDD:239140 15/70 (21%)
PKc_like 343..665 CDD:304357
Snx16NP_083344.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
PX_SNX16 105..214 CDD:132809 23/108 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.