DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Rps6ka5

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_705815.1 Gene:Rps6ka5 / 73086 MGIID:1920336 Length:863 Species:Mus musculus


Alignment Length:396 Identity:91/396 - (22%)
Similarity:153/396 - (38%) Gaps:141/396 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 DTTDGG----SVSHLECPWN--------QLARYKVLQIL----QDRVMQVQCVT----------K 365
            |:.|||    :|.|.....|        .:..:::|::|    ..:|..|:.::          |
Mouse    16 DSGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISGHDAGKLYAMK 80

  Fly   366 SQQPAAIMKGVEKPASHSLTQSIFLP--QQVPYMVQLLAYFQSEQKIFLLLRQAEGGMLYDYLQS 428
            ..:.|.|::.. |...|:.|:...|.  :|.|::|.|...||:|.|:.|:|         ||   
Mouse    81 VLKKATIVQKA-KTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLIL---------DY--- 132

  Fly   429 YTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSDLVRSSQQLLKSVTNTLSNLQAGVVTP 493
                    :|.||||....:.|.                                          
Mouse   133 --------INGGELFTHLSQRER------------------------------------------ 147

  Fly   494 KRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKGVILRDLHMGNILLGAKGQLLLTYFYQ 558
                           ..|..::.:..|:.:|:..||..|:|.||:.:.||||.:.|.::||.|..
Mouse   148 ---------------FTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGL 197

  Fly   559 NEGLTSDDNYVHKALNLEAVANHFVAPERPLTFRS---------DWWSYGVVLYQLLLGV-PYKV 613
            ::...:|:  ..:|.:..... .::||:   ..|.         ||||.||::|:||.|. |:.|
Mouse   198 SKEFVADE--TERAYSFCGTI-EYMAPD---IVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTV 256

  Fly   614 THPGQLDLYGCVQ---------YPSESLEISDHAKDLLEQLLQLSPELRL-----DYDQLQAHPF 664
              .|:.:....:.         ||.   |:|..|||||::||...|:.||     |.::::.|.|
Mouse   257 --DGEKNSQAEISRRILKSEPPYPQ---EMSTVAKDLLQRLLMKDPKKRLGCGPRDAEEIKEHLF 316

  Fly   665 FKGIDW 670
            |:.|.|
Mouse   317 FEKIKW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357 80/361 (22%)
Rps6ka5NP_705815.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/5 (60%)
PKc_like 47..379 CDD:304357 84/365 (23%)
S_TKc 48..317 CDD:214567 80/357 (22%)
STKc_MSK1_C 417..791 CDD:271081
S_TKc 429..751 CDD:214567
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 805..863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.