DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx20

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_082116.1 Gene:Snx20 / 71607 MGIID:1918857 Length:313 Species:Mus musculus


Alignment Length:236 Identity:47/236 - (19%)
Similarity:80/236 - (33%) Gaps:87/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VVWKRFHDVKRLHRELSRR---------HKSLQLPGKLPVPTDSTYFKRFDAAVIQRR---KEYI 98
            ||.:|:.|.:||.:.|.:|         ....:|.|.|...|           :.:||   :||:
Mouse   109 VVERRYSDFERLQKALLKRFGPELEDVAFPRKRLTGNLSAET-----------ICERRRELREYL 162

  Fly    99 ------------LQLLDFAAQHPAL---YKCSTFTQFFQETPSPNGSPLKKLYVERSLRLQTEDN 148
                        .:.|||..: |.|   :.|....|:.:...          .:.|:|.||.:  
Mouse   163 RLLYAVRAVRRSREFLDFLTR-PELREAFGCLRAGQYARALE----------LLGRALPLQEK-- 214

  Fly   149 GCGSGGSETGTC-AGAIADICDKLDLPYD---PHDAGGITPLDPRCDKEQTNN------------ 197
                   .|..| :.|:..:|..|....|   |.:|..:.....||.:.:.|:            
Mouse   215 -------LTAHCPSAAVPALCAALVCLRDLERPAEAFAVGERALRCLRTRENHRYYAPLLDAMVR 272

  Fly   198 ------------ESQAKETEIELETKQEPKTDVALTKRDYL 226
                        :|:..|.::...|.:: .|...||.|:||
Mouse   273 LAYALGKDFAALQSRLDENQLRRPTHRD-ATLKELTVREYL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 23/104 (22%)
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357
Snx20NP_082116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60
PX_domain 73..186 CDD:383026 20/88 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.