DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx29

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_038942785.1 Gene:Snx29 / 689142 RGDID:1596162 Length:838 Species:Rattus norvegicus


Alignment Length:316 Identity:69/316 - (21%)
Similarity:108/316 - (34%) Gaps:103/316 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 QSIFLPQQVPYMVQLLAYFQSEQKIFLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPE 450
            ||.|    .|.:..||.  :|.|.:..||:::..|| ...|:..|.:|:.|:..        :||
  Rat   205 QSKF----APTVSDLLK--ESTQNMTSLLKESTQGM-SSLLREITASSAVSILI--------KPE 254

  Fly   451 EKEAEEPPLTSDSDVSDLVRSSQQLLKSVTNTLS----NLQAGV-----VTPKRNKKVDQNRIRS 506
            ::....|.::.:..|....:..::..|.|||.:|    :.:.|.     ..|...:..::|..||
  Rat   255 QETDPLPVISKNVHVDARCKRERRRRKKVTNIVSFDDDDEEQGAGDTLKKMPGTAESSEENSDRS 319

  Fly   507 K---------PI-----PEQCLRQWACELAIAIHSLHGKGVILRDLHMGNILLGAKGQLLLTYFY 557
            .         |.     ..|....|..:.|    ||:|:             ||          |
  Rat   320 SVNIMAAFEGPFGPNSNGSQSSNSWKMDSA----SLNGE-------------LG----------Y 357

  Fly   558 QNEGLTSDDNYVHKALNLEAV---------ANHFVAPERPLTFRSDWWSYGVVLYQLLLGVPYKV 613
            |...:.|.|:.|.:  :.|||         ..|..:|:|.|...:.       |.|:....|.:|
  Rat   358 QKLDVKSIDDDVDE--SEEAVYRNPLGRGHTGHKESPDRTLDGNAS-------LPQVHGWAPLQV 413

  Fly   614 THPGQLDL-------------YGCVQYPSESLEISDHAKDLLEQLLQLSPELRLDY 656
            .| |..|.             ||....|..|||.....:|      .:.||..|.|
  Rat   414 LH-GDADADTDILFPVSGVGSYGTADAPVGSLENGTGTED------HILPEPGLRY 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357 69/316 (22%)
Snx29XP_038942785.1 RUN 64..197 CDD:397055
COG1340 489..654 CDD:224259
PX_RUN 681..798 CDD:132810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.