DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and RPS6KA2

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_006715612.1 Gene:RPS6KA2 / 6196 HGNCID:10431 Length:761 Species:Homo sapiens


Alignment Length:341 Identity:78/341 - (22%)
Similarity:136/341 - (39%) Gaps:121/341 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 LQILQDRVMQVQCVTKSQQPAAIMKGVEKPASHSLTQSIFLPQQVPYMVQLLAYFQSEQKIFLLL 414
            :::|:...::|:...:|:....|:..|    :|            |::|:|...||:|.|::|:|
Human   118 MKVLKKATLKVRDRVRSKMERDILAEV----NH------------PFIVKLHYAFQTEGKLYLIL 166

  Fly   415 RQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSDLVRSSQQLLKSV 479
                     |:|:.           |:||                         .|.|::::   
Human   167 ---------DFLRG-----------GDLF-------------------------TRLSKEVM--- 183

  Fly   480 TNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKGVILRDLHMGNIL 544
                                         ..|:.::.:..|||:|:..||..|:|.|||...|||
Human   184 -----------------------------FTEEDVKFYLAELALALDHLHSLGIIYRDLKPENIL 219

  Fly   545 LGAKGQLLLTYF-YQNEGLTSDDNYVHKALNLEAVANHFVAPE----RPLTFRSDWWSYGVVLYQ 604
            |..:|.:.:|.| ...|.:..|.........:|     ::|||    |..|..:||||:||::::
Human   220 LDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIE-----YMAPEVVNRRGHTQSADWWSFGVLMFE 279

  Fly   605 LLLG-VPY-----KVTHPGQLDL-YGCVQYPSESLEISDHAKDLLEQLLQLSPELRL-----DYD 657
            :|.| :|:     |.|....|.. .|..|:      :|..|:.||..|.:.:|..||     ..:
Human   280 MLTGSLPFQGKDRKETMALILKAKLGMPQF------LSGEAQSLLRALFKRNPCNRLGAGIDGVE 338

  Fly   658 QLQAHPFFKGIDWQAV 673
            :::.||||..|||..:
Human   339 EIKRHPFFVTIDWNTL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357 73/331 (22%)
RPS6KA2XP_006715612.1 S_TKc 87..346 CDD:214567 73/331 (22%)
STKc_RSK_N 91..407 CDD:270734 78/341 (23%)
STKc_RSK3_C 439..731 CDD:271080
Pkinase 443..700 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.