DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and snx24

DIOPT Version :10

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001028903.1 Gene:snx24 / 619249 ZFINID:ZDB-GENE-050913-45 Length:172 Species:Danio rerio


Alignment Length:133 Identity:36/133 - (27%)
Similarity:54/133 - (40%) Gaps:46/133 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GYTIYKITSIVFPRSVPQALTC---LVVWKRFHDVKRLHRELSRRHKSLQLPGKLPVPTDSTYFK 84
            |||::||          :.|.|   ..|.||:.:...|||.|.:..|..::|.|        :.:
Zfish    21 GYTVFKI----------EVLMCGRQHTVEKRYSEFHALHRMLKKIIKPPEIPSK--------HVR 67

  Fly    85 RFDAAVIQRRK---EYILQ------------LLDFA-AQH-PALYK---CSTFTQFFQETPSPNG 129
            .:...|:::|:   |..||            .|||. .:| |:|.|   |.:|     ||.|...
Zfish    68 NWVPKVLEQRRQGLELYLQTIIMENEVLPKIFLDFLNIRHFPSLPKTESCGSF-----ETESDES 127

  Fly   130 SPL 132
            |.|
Zfish   128 SKL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 31/123 (25%)
MIT_SNX15 241..315 CDD:239140
Protein Kinases, catalytic domain 343..665 CDD:473864
snx24NP_001028903.1 PX_SNX22 4..113 CDD:132790 28/109 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.