DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and rps6ka2

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_699952.2 Gene:rps6ka2 / 571285 ZFINID:ZDB-GENE-090827-1 Length:733 Species:Danio rerio


Alignment Length:415 Identity:90/415 - (21%)
Similarity:159/415 - (38%) Gaps:129/415 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RRFIAKAKIAKYLARAEEIHANFLA---NDCPTKKLQFQLSLDTTDGGSVSHLECPWNQLARYKV 349
            |:|..:...:.||.|.....::.|.   :|...|  :|.:|....:|...:       ..:::::
Zfish     6 RKFTVRRWFSVYLRRKSRSKSSSLCKLEDDSILK--EFDISHHVKEGFEKA-------DPSQFEL 61

  Fly   350 LQIL----QDRVMQVQCVTKSQQPAAIMKGVEKPAS--------HSLTQSIFLPQQVPYMVQLLA 402
            |::|    ..:|..|:.:..|.........|.|.|:        ..:.:.|......|::|:|..
Zfish    62 LKVLGQGSYGKVFLVRKIKGSDTGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHY 126

  Fly   403 YFQSEQKIFLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSD 467
            .||:|.|::|:|         |:|:.           |:||                        
Zfish   127 AFQTEGKLYLIL---------DFLRG-----------GDLF------------------------ 147

  Fly   468 LVRSSQQLLKSVTNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKG 532
             .|.|::::                                ..|:.::.:..|||:|:..||..|
Zfish   148 -TRLSKEVM--------------------------------FTEEDVKFYLAELALALDHLHSLG 179

  Fly   533 VILRDLHMGNILLGAKGQLLLTYF-YQNEGLTSDDNYVHKALNLEAVANHFVAPE----RPLTFR 592
            :|.|||...||||..:|.:.:|.| ...|.:..|.........:|     ::|||    |..|..
Zfish   180 IIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIE-----YMAPEVVNRRGHTQS 239

  Fly   593 SDWWSYGVVLYQLLLG-VPY-----KVTHPGQLDL-YGCVQYPSESLEISDHAKDLLEQLLQLSP 650
            :||||:||:::::|.| :|:     |.|....|.. .|..|:      :|...:.||..|.:.:|
Zfish   240 ADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQF------LSPEVQSLLRALFKRNP 298

  Fly   651 ELRL-----DYDQLQAHPFFKGIDW 670
            ..||     ..::::.|.||..|||
Zfish   299 SNRLGAGPDGVEEIKRHIFFATIDW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 6/29 (21%)
PKc_like 343..665 CDD:304357 74/350 (21%)
rps6ka2XP_699952.2 S_TKc 59..318 CDD:214567 74/346 (21%)
STKc_RSK_N 63..379 CDD:270734 78/349 (22%)
PKc_like 411..703 CDD:304357
Pkinase 415..672 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.