DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and snx14

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_005160372.1 Gene:snx14 / 555970 ZFINID:ZDB-GENE-040724-144 Length:942 Species:Danio rerio


Alignment Length:173 Identity:36/173 - (20%)
Similarity:63/173 - (36%) Gaps:50/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 RYKVLQILQDRVMQ-----VQCVTKSQQPAAIMKGVEKPA---------------------SHSL 384
            |..|..::.|::|:     ::.:.|:||......|:|:.|                     ...|
Zfish   182 RVDVPSVVMDKMMKAAMKHIEIIAKAQQKVRNTDGLEQAALAEYGADLHVALRSRKDELLYLRKL 246

  Fly   385 TQSIFLPQQVPYMVQLLAYFQSEQKIFLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEP 449
            |:.:|     ||::...|  ...:.:.||:|:...|.::..:..:. ....:||:..|...|..|
Zfish   247 TELLF-----PYVMPPKA--TDCRSLALLIREVMTGSVFLPIMDFV-ADPDTVNHMVLIFIDDSP 303

  Fly   450 EEKEAEEP------------PLTSDSDVSDL----VRSSQQLL 476
            .|...:.|            |.|..|.|..|    :|..|.||
Zfish   304 PEPVTDPPSTLVPFLERFADPRTKKSSVLKLDLKEIREQQDLL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357 36/173 (21%)
snx14XP_005160372.1 PXA 130..299 CDD:280373 23/124 (19%)
RGS_SNX14 339..465 CDD:188677 4/8 (50%)
PX_SNX14 563..681 CDD:132787
Nexin_C 802..905 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.