DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Rps6ka3

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_017457618.1 Gene:Rps6ka3 / 501560 RGDID:1563860 Length:759 Species:Rattus norvegicus


Alignment Length:407 Identity:91/407 - (22%)
Similarity:161/407 - (39%) Gaps:133/407 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 IHANFLAN-----DCPTKKLQFQLSLDTTDGGSVSHLECPWN--------QLARYKVLQILQD-- 355
            :|..||.|     |.|..:.:..   ..|:.||:..:....:        ..:::::|::|..  
  Rat    36 VHRFFLQNGQQIMDEPMGEEEIN---PQTEEGSIKEIAITHHVKEGHEKADPSQFELLKVLGQGS 97

  Fly   356 --RVMQVQCVTKSQQPAAIMKGVEKPAS--------HSLTQSIFLPQQVPYMVQLLAYFQSEQKI 410
              :|..|:.::.|.........|.|.|:        ..:.:.|.:....|::|:|...||:|.|:
  Rat    98 FGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKL 162

  Fly   411 FLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSDLVRSSQQL 475
            :|:|         |:|:.           |:||                         .|.|:::
  Rat   163 YLIL---------DFLRG-----------GDLF-------------------------TRLSKEV 182

  Fly   476 LKSVTNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKGVILRDLHM 540
            :                                ..|:.::.:..|||:|:..||..|:|.|||..
  Rat   183 M--------------------------------FTEEDVKFYLAELALALDHLHSLGIIYRDLKP 215

  Fly   541 GNILLGAKGQLLLTYFYQNEGLTSDD-NYVHKALNLEAVANHFVAPE----RPLTFRSDWWSYGV 600
            .||||..:|.:.||.|    ||:.:. ::..||.:..... .::|||    |..|..:||||:||
  Rat   216 ENILLDEEGHIKLTDF----GLSKESIDHEKKAYSFCGTV-EYMAPEVVNRRGHTQSADWWSFGV 275

  Fly   601 VLYQLLLG-VPY-----KVTHPGQLDL-YGCVQYPSESLEISDHAKDLLEQLLQLSPELRL---- 654
            :::::|.| :|:     |.|....|.. .|..|:      :|..|:.||..|.:.:|..||    
  Rat   276 LMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQF------LSPEAQSLLRMLFKRNPANRLGAGP 334

  Fly   655 -DYDQLQAHPFFKGIDW 670
             ..::::.|.||..|||
  Rat   335 DGVEEIKRHSFFSTIDW 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 4/13 (31%)
PKc_like 343..665 CDD:304357 77/350 (22%)
Rps6ka3XP_017457618.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.