DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and snx16

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_991228.1 Gene:snx16 / 402964 ZFINID:ZDB-GENE-040426-1832 Length:294 Species:Danio rerio


Alignment Length:211 Identity:38/211 - (18%)
Similarity:74/211 - (35%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DTQEHKGGYTIYKITSIVFPRSVPQALTCLVVWKRFHDVKRLHRELSRRHKSLQLPG-KLPVPTD 79
            :..|.:..:|:||   ::..::|.::   .||::|:.|..||:.:|..     ..|| :|.:|..
Zfish    74 EVMEERAKFTVYK---VLVRKNVDES---WVVFRRYTDFSRLNDKLKD-----MFPGFRLSLPPK 127

  Fly    80 STYFKRFDAAVIQRRKEYILQLLDFAAQHPALYKCSTFTQF--FQETPSPNGS------------ 130
            ..:...::...::.|:..:...|.....|..:..|....:|  ..:.|.|..|            
Zfish   128 RWFKDNYETEFLEERQLGLQTFLQNLVAHKDIASCVAVREFLCLDDPPGPFDSLEESRAFCETLE 192

  Fly   131 ------------------PLKKLYVERSLRLQ-----------TEDNGC-----GSGGSET---- 157
                              .||:...|:.|::|           |.|:.|     .|..:|.    
Zfish   193 ECNYRLQKELLEKQREINSLKETLEEKELQIQKLEERISGPLLTPDSTCCVSDVESSAAEADQEL 257

  Fly   158 ---GTCAG--AIADIC 168
               |.|.|  :.:.:|
Zfish   258 LDDGLCVGQSSQSSVC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 21/110 (19%)
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357
snx16NP_991228.1 PX_SNX16 63..172 CDD:132809 21/108 (19%)
DUF4200 <181..230 CDD:290574 5/48 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.