Sequence 1: | NP_650697.1 | Gene: | CG7156 / 42187 | FlyBaseID: | FBgn0038588 | Length: | 681 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991228.1 | Gene: | snx16 / 402964 | ZFINID: | ZDB-GENE-040426-1832 | Length: | 294 | Species: | Danio rerio |
Alignment Length: | 211 | Identity: | 38/211 - (18%) |
---|---|---|---|
Similarity: | 74/211 - (35%) | Gaps: | 69/211 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 DTQEHKGGYTIYKITSIVFPRSVPQALTCLVVWKRFHDVKRLHRELSRRHKSLQLPG-KLPVPTD 79
Fly 80 STYFKRFDAAVIQRRKEYILQLLDFAAQHPALYKCSTFTQF--FQETPSPNGS------------ 130
Fly 131 ------------------PLKKLYVERSLRLQ-----------TEDNGC-----GSGGSET---- 157
Fly 158 ---GTCAG--AIADIC 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7156 | NP_650697.1 | PX_SNX15_like | 8..124 | CDD:132791 | 21/110 (19%) |
MIT_SNX15 | 241..315 | CDD:239140 | |||
PKc_like | 343..665 | CDD:304357 | |||
snx16 | NP_991228.1 | PX_SNX16 | 63..172 | CDD:132809 | 21/108 (19%) |
DUF4200 | <181..230 | CDD:290574 | 5/48 (10%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |