DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and snx15

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001104707.1 Gene:snx15 / 393352 ZFINID:ZDB-GENE-040426-1377 Length:398 Species:Danio rerio


Alignment Length:393 Identity:97/393 - (24%)
Similarity:158/393 - (40%) Gaps:100/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FTVTDTQEHKGGYTIYKITSIVFPRSVPQALTCLVVWKRFHDVKRLHRELSRRHKSL-----QLP 71
            |:|||.:.|:.|:|.||:|:....::.|:.:..:|||||:.::|:||.||:..|::|     :.|
Zfish    14 FSVTDPRTHEKGHTEYKVTARFVSKTQPENVKEVVVWKRYTELKKLHGELAYTHRNLFRRQEEFP 78

  Fly    72 GKLPVPTDSTYFKRFDAAVIQRRKEYILQLLDFAAQHPALYKCSTFTQFFQE------------- 123
               |.|. :..|.|||.|||:.|:.....:|.|....||||......:||::             
Zfish    79 ---PFPR-AQVFGRFDEAVIEERRNAAEAMLLFTTNIPALYNSPQLKEFFRDGEVRRPLETAVIS 139

  Fly   124 -------TPSPNGS-------------PLKKLYVERSLRL------------------------- 143
                   .|.|..|             |::...::.:.||                         
Zfish   140 TSLPPPLIPLPERSADLLAEEETGTEAPIQAQELDSNQRLTDLTQPEIAVEALSDTRSSPTQETQ 204

  Fly   144 -----------QTEDNGCGSGGSETGTCAGAIADICDKL--DLPYDPHDAGGITPLDPRCDKEQT 195
                       :|||:......:.||.|..|..|.....  ::|..|.|.  :...|...|....
Zfish   205 TDAEIQELTEKETEDDSTTHENNHTGQCTAATDDSTTHASPEMPGSPIDQ--LEEFDALFDSGLE 267

  Fly   196 NNESQA----KETEIELETKQEP--KTDVALTKRDYLRLLT-PMASIESDDS----DYIYEAALE 249
            :...:|    .:|::.:   .:|  |.|.......:..||: |:......||    .|:|:|..|
Zfish   268 DYSFKAPPLLSDTDLAI---FDPCVKEDQPYGSPSHAELLSAPLCGSNGTDSAVDVSYVYQANEE 329

  Fly   250 FSHAVQAEVNLEYAEAHERYKHGVDLLLNGAKQDSSEERRFIAKAKIAKYLARAEEIHANFLAND 314
            .:.|.:.|....|:.|.:||:..||:.:.|.:.|...:||...|.|||:.|..||.:    |:..
Zfish   330 LNAAQEQEREGNYSTAVQRYRAAVDIFMKGVQGDVDLKRRDAVKRKIAEVLEHAERL----LSIQ 390

  Fly   315 CPT 317
            .||
Zfish   391 TPT 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 42/136 (31%)
MIT_SNX15 241..315 CDD:239140 24/73 (33%)
PKc_like 343..665 CDD:304357
snx15NP_001104707.1 PX_SNX15 10..127 CDD:132821 42/116 (36%)
MIT_SNX15 321..395 CDD:239140 26/77 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8374
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D135297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25822
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15508
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.