DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx16

DIOPT Version :10

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster


Alignment Length:113 Identity:25/113 - (22%)
Similarity:46/113 - (40%) Gaps:11/113 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DTQEHKGGYTIYKITSIVFPRSVPQALTCLVVWKRFHDVKRLHRELSRRHKSLQLPGKLPVPTDS 80
            :..|.:..:|.||:..     ..|:.....:|.:|:.|..||:.:|.:...:|    .|.:|...
  Fly   230 EVMEERARFTAYKLRV-----ENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL----TLMLPRKK 285

  Fly    81 TYFKRFDAAVIQRRKEYILQLLDFAAQHPALYKCSTFTQFF--QETPS 126
            .:...|:|..:..|.:.:...::.......|.||....:||  .|.||
  Fly   286 LFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 22/109 (20%)
MIT_SNX15 241..315 CDD:239140
Protein Kinases, catalytic domain 343..665 CDD:473864
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.