DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Rps6ka4

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001101987.2 Gene:Rps6ka4 / 361715 RGDID:1307277 Length:773 Species:Rattus norvegicus


Alignment Length:332 Identity:80/332 - (24%)
Similarity:130/332 - (39%) Gaps:110/332 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 KSQQPAAIMKGVEKPASHSLTQS--IFLPQQVPYMVQLLAYFQSEQKIFLLLRQAEGGMLYDYLQ 427
            |..:.||:::.. |...|:.|:.  :.|.:|.|::|.|...||::.|:.|:|....||.::.:|.
  Rat    65 KVLRKAALVQRA-KTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSGGEMFTHLY 128

  Fly   428 SYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSDLVRSSQQLLKSVTNTLSNLQAGVVT 492
                               |....||||                                     
  Rat   129 -------------------QRQYFKEAE------------------------------------- 137

  Fly   493 PKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKGVILRDLHMGNILLGAKGQLLLTYF- 556
                                 :|.:..|:.:|:..||..|:|.|||.:.|:||.::|.::||.| 
  Rat   138 ---------------------VRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDFG 181

  Fly   557 YQNEGLTSDDNYVHKALNLEAVANHFVAPERPLTFRS--------DWWSYGVVLYQLLLGV-PYK 612
            ...|.||.:.........    ...::|||   ..||        ||||.|::|::||.|. |: 
  Rat   182 LSKEFLTEEKERTFSFCG----TIEYMAPE---IIRSKAGHGKAVDWWSLGILLFELLTGASPF- 238

  Fly   613 VTHPGQLDLYGCVQ------YPSESLEISDHAKDLLEQLLQLSPELRL-----DYDQLQAHPFFK 666
             |..|:.:....|.      .|.....|...|:|||::||...|:.||     ...::::|.||:
  Rat   239 -TLEGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVKSHLFFQ 302

  Fly   667 GIDWQAV 673
            |:||.|:
  Rat   303 GLDWVAL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357 74/322 (23%)
Rps6ka4NP_001101987.2 STKc_MSK2_N 32..364 CDD:270765 80/332 (24%)
PKc_like 404..714 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.