DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and CG5439

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster


Alignment Length:482 Identity:94/482 - (19%)
Similarity:166/482 - (34%) Gaps:169/482 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 HERYKHGVDLLLNGAKQ---DSSEERRFI--------AKAKIAKYLARAEEIHA-----NFLAND 314
            |||.:: :||     ||   :....|.||        ..:.:..:|:..|::|.     :.|.||
  Fly   125 HERQRY-MDL-----KQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLND 183

  Fly   315 CPTKKLQ----------FQLSLDTTD-------GGSVSHLE-------CPWNQLARYKVLQILQD 355
            ...|||.          |.|::|||:       ..||:..|       .|...:.|.|...|..:
  Fly   184 EAAKKLPEIVDSLSDVLFALNVD
TTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVE 248

  Fly   356 RVMQVQCVTKSQQPAAIMKGVEKP------ASHSLTQSIFLPQQVPYMVQLLAYFQSEQKIFLLL 414
            |  .::||:.::.....:|.:|..      :..|:.|.:..||:   .|.|..:...|.::    
  Fly   249 R--PIECVSSTEDLLGALKPIESVEVQQILSKESIEQELAQPQE---EVNLGPFDPIEPEL---- 304

  Fly   415 RQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSDLVRSSQQ-LLKS 478
                     ::|::..|.....|...||:....:...:.::     |.|..:.|..|.|| .|:.
  Fly   305 ---------EFLKTPLPDIGAHVGESELYEDRSDTSSQWSK-----SSSSANCLANSQQQAALEE 355

  Fly   479 VTNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKGVILRDLHMGNI 543
            ..|.|:                          |:|.   ..|..:|..||..:.:|.|       
  Fly   356 HVNQLN--------------------------ERCA---LLETRVAELSLQNRLLIRR------- 384

  Fly   544 LLGAKGQLLLTYFYQNEGLTSD----DNYV----H-KALNLEAVANHFVAPERPLTFRS--DWWS 597
                     ||..::..|:...    .|::    | |....:...:|:.. |..:|.|.  :.|:
  Fly   385 ---------LTKQFEETGIDPSSSLCSNFLITIPHVKLAKTQRSGSHYTY-EVHITMRQRLEHWT 439

  Fly   598 Y------GVVLYQLLLGVPYKVTHPGQLDLYGCVQYPSES-------LEISDHAKDLLEQLLQLS 649
            :      ...|::.||     .|||    :...|::|.:.       :.:.:..:.|...||.|.
  Fly   440 FFRRYSEFYKLHKSLL-----KTHP----VVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLV 495

  Fly   650 PELRLDYDQLQA----------HPFFK 666
            ..|    .|::|          .|||:
  Fly   496 ETL----PQVEACKSKAELQKVFPFFR 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 15/64 (23%)
PKc_like 343..665 CDD:304357 64/362 (18%)
CG5439NP_609607.1 RUN 64..206 CDD:280855 21/86 (24%)
PX_RUN 404..520 CDD:132810 25/129 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.