DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Rps6ka6

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001178650.1 Gene:Rps6ka6 / 317203 RGDID:1560817 Length:860 Species:Rattus norvegicus


Alignment Length:539 Identity:111/539 - (20%)
Similarity:205/539 - (38%) Gaps:166/539 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KEQTNNESQAKETEIELETKQEPKTDVALTKRDYLRLLTPMASIESDDSDYIYEAALE------- 249
            :.|:.:..:|....:.| .:..|....|:|:|:       ..|.|.|     :|.|.:       
  Rat    32 RRQSRSRQRAGTPVVPL-LRYPPLARSAVTQRE-------SWSYEED-----HEPAQQAGCMLVL 83

  Fly   250 ----FSHAVQAEVNLEYAEAHERYKHGVDLLLNGAKQDSSEERRFIAKAKIAKYLARAEEIHANF 310
                |..:|.....|.:|...:.:...:::.  |:...||.|.:.:...|.|..:.|..| |.. 
  Rat    84 GTSSFFSSVPEAAMLPFAPVEDPWDEEMEVF--GSGSTSSSEPQIVFTMKTAAMVIRQHE-HKE- 144

  Fly   311 LAND---------------CPTKKLQFQLSLDTTDGGSVSHLECPWNQL--ARYKVLQIL-QDRV 357
             .||               |..:.|..::.:       ..|::..:.:.  |::.:|::| |...
  Rat   145 -VNDLKMVDEPMDEGEPVFCRREDLVKEIPI-------TQHVKEGYEKADPAQFDLLKVLGQGSF 201

  Fly   358 MQVQCVTKSQQPAA----IMKGVEKPA-------SHSLTQSIFLPQQVPYMVQLLAYFQSEQKIF 411
            .:|..|.|...|.|    .||.:.|.:       ...:.:.|.:....|::|:|...||:|.|::
  Rat   202 GKVFLVRKKTGPDAGQLYAMKVLRKASLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY 266

  Fly   412 LLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSDLVRSSQQLL 476
            |:|         |:|:.           |::|                         .|.|:::|
  Rat   267 LIL---------DFLRG-----------GDVF-------------------------TRLSKEVL 286

  Fly   477 KSVTNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKGVILRDLHMG 541
                                            ..|:.::.:..|||:|:..||..|::.|||...
  Rat   287 --------------------------------FTEEDVKFYLAELALALDHLHRLGIVYRDLKPE 319

  Fly   542 NILLGAKGQLLLTYFYQNEGLTSDDNYVHKALNLEAVANHFVAPE----RPLTFRSDWWSYGVVL 602
            ||||...|.:.||.|    ||:.:.....|..........::|||    |..:..:|||||||::
  Rat   320 NILLDEIGHIKLTDF----GLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLM 380

  Fly   603 YQLLLG-VPYKVTHPGQ-LDL-----YGCVQYPSESLEISDHAKDLLEQLLQLSPELRL---DYD 657
            :::|.| :|::.....: :::     .|..|:      :|..|:.||..|.:.:|..||   ..:
  Rat   381 FEMLTGTLPFQGKDRNETMNMILKAKLGMPQF------LSAEAQSLLRMLFKRNPANRLGSEGVE 439

  Fly   658 QLQAHPFFKGIDWQAVLEQ 676
            :::.|.||..|||..:.::
  Rat   440 EVKRHAFFSSIDWNKLYKR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 17/99 (17%)
PKc_like 343..665 CDD:304357 76/349 (22%)
Rps6ka6NP_001178650.1 S_TKc 190..447 CDD:214567 75/343 (22%)
STKc_RSK_N 194..508 CDD:270734 79/352 (22%)
STKc_RSK_C 543..829 CDD:270993
Pkinase 543..800 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.