DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and snz

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster


Alignment Length:416 Identity:83/416 - (19%)
Similarity:135/416 - (32%) Gaps:124/416 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 IAKAKIAKYLAR------AEEIHANFLANDCPTKKLQFQLSLDTTDGGSVSHLE---------CP 340
            :.|.|:...:.|      .::||...|..|  ..|:   :::|..:..:| |||         ..
  Fly   166 VTKPKLINDVVREDLWNAIQKIHERALRMD--AAKI---IAVDMVNRVTV-HLEKIRIAEARAAE 224

  Fly   341 WNQLARYKVLQILQDRVMQVQCVTKSQQPAAIM---KGVEKP-----ASHSLTQSIFLPQQVPYM 397
            .|....:.....|.|...:::.:.|..:...|:   :|...|     .|..|:..||.|     |
  Fly   225 TNTPPVFSTNSYLADEEKEMEFLRKLCEIMVILLLPRGYSLPPLKVLLSEILSYKIFFP-----M 284

  Fly   398 VQLLA---YFQSEQKIFLLLRQAEGGM---LYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEE 456
            :::|.   |...:....:..|.|...|   .|:|..|:........|.|.|            ||
  Fly   285 IKMLTAPDYINQKVVQNIETRLAAAAMSKRSYEYAASFEDFLKIINNSGNL------------EE 337

  Fly   457 PPLTSDSDVSDLVRSSQQLLKSVTNTLSNLQAGVVTPKRNKKVDQNR-------------IRSKP 508
            ..|...|.|:||:.::         |:.|||       |.|.:|.:.             :|.|.
  Fly   338 LSLIRKSIVNDLMHAT---------TMQNLQ-------RAKGLDPDHEDHSLSKSELTAAVRLKR 386

  Fly   509 IPEQ-CLRQWACELAIAIHSLHGKGVILRDLHMGNILLGAKGQLLLTYFYQNEGLTSDDNYVHKA 572
            ...| .:.:..||..:|....:|......||.:..||..|.|:...|.|.:             .
  Fly   387 YVRQLTMAKGECEKNLAKFGWNGNYSSDIDLTLVEILNTAVGRRYFTLFLE-------------P 438

  Fly   573 LNLEAVANHFVAPERPLTFRSDWWSYGVVLYQLLLGVPYKVTHP------GQLDLYGCVQYPSES 631
            |...|:...::|.|.                       .|..|.      |....|..::.|...
  Fly   439 LKASALIGFYLAVEE-----------------------IKHAHKSASHQLGTEIFYTYIRVPKSE 480

  Fly   632 LEISDHAKDLLEQLLQLSPELRLDYD 657
            ::|..|.:.|:|..|....|..:.||
  Fly   481 IQIDKHERKLIETFLLGDAEPDIFYD 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 6/29 (21%)
PKc_like 343..665 CDD:304357 69/349 (20%)
snzNP_001284993.1 PXA 142..299 CDD:280373 28/143 (20%)
RGS_SNX25 422..531 CDD:188675 23/121 (19%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.