DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and RPS6KA6

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_016884912.1 Gene:RPS6KA6 / 27330 HGNCID:10435 Length:762 Species:Homo sapiens


Alignment Length:358 Identity:81/358 - (22%)
Similarity:147/358 - (41%) Gaps:113/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 ARYKVLQIL-QDRVMQVQCVTKSQQPAA----IMKGVEKPA-------SHSLTQSIFLPQQVPYM 397
            |::::|::| |....:|..|.|...|.|    .||.::|.:       ...:.:.|.:....|::
Human    88 AQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRTKMERDILVEVNHPFI 152

  Fly   398 VQLLAYFQSEQKIFLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSD 462
            |:|...||:|.|::|:|         |:|:.           |::|                   
Human   153 VKLHYAFQTEGKLYLIL---------DFLRG-----------GDVF------------------- 178

  Fly   463 SDVSDLVRSSQQLLKSVTNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHS 527
                  .|.|:::|                                ..|:.::.:..|||:|:..
Human   179 ------TRLSKEVL--------------------------------FTEEDVKFYLAELALALDH 205

  Fly   528 LHGKGVILRDLHMGNILLGAKGQLLLTYFYQNEGLTSDDNYVHKALNLEAVANHFVAPE----RP 588
            ||..|::.|||...||||...|.:.||.|    ||:.:.....|..........::|||    |.
Human   206 LHQLGIVYRDLKPENILLDEIGHIKLTDF----GLSKESVDQEKKAYSFCGTVEYMAPEVVNRRG 266

  Fly   589 LTFRSDWWSYGVVLYQLLLG-VPYKVTHPGQ-LDL-----YGCVQYPSESLEISDHAKDLLEQLL 646
            .:..:|||||||:::::|.| :|::.....: :::     .|..|:      :|..|:.||..|.
Human   267 HSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQF------LSAEAQSLLRMLF 325

  Fly   647 QLSPELRL---DYDQLQAHPFFKGIDWQAVLEQ 676
            :.:|..||   ..::::.|.||..|||..:.::
Human   326 KRNPANRLGSEGVEEIKRHLFFANIDWDKLYKR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357 76/345 (22%)
RPS6KA6XP_016884912.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.