DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and SNX20

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_878274.1 Gene:SNX20 / 124460 HGNCID:30390 Length:316 Species:Homo sapiens


Alignment Length:279 Identity:56/279 - (20%)
Similarity:76/279 - (27%) Gaps:125/279 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FD--AAVIQRRKEYILQLLDFAAQHPALYKCSTFTQFFQETPSP----NGSPLKKLYVERSLRLQ 144
            ||  .||::||..      |||....||.|  ||.:..::...|    .|:..:::..||...||
Human   106 FDNNKAVLERRYS------DFAKLQKALLK--TFREEIEDVEFPRKHLTGNFAEEMICERRRALQ 162

  Fly   145 ---------------------------TEDNGCGSGGSE-----------------TGTC-AGAI 164
                                       .|..||...|..                 |..| |.|:
Human   163 EYLGLLYAIRCVRRSREFLDFLTRPELREAFGCLRAGQYPRALELLLRVLPLQEKLTAHCPAAAV 227

  Fly   165 ADIC------DKLDLPYDPHDAGGITPLDPRCDKEQTNNESQAKETEIELETKQEPKTDVALTKR 223
            ..:|      ..||.|.:...||           |:.....||:|..                 |
Human   228 PALCAVLLCHRDLDRPAEAFAAG-----------ERALQRLQAREGH-----------------R 264

  Fly   224 DYLRLLTPMASIESDDSDYIYEAALEFSHAVQAEVNLEYAEAHERYKHGVDLLLNGAKQDSSEER 288
            .|..||..|                         |.|.||       .|.|.:....:.:.|:.|
Human   265 YYAPLLDAM-------------------------VRLAYA-------LGKDFVTLQERLEESQLR 297

  Fly   289 RFIAKAKIAKYLARAEEIH 307
            |...:....|.|...|.:|
Human   298 RPTPRGITLKELTVREYLH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 14/39 (36%)
MIT_SNX15 241..315 CDD:239140 13/67 (19%)
PKc_like 343..665 CDD:304357
SNX20NP_878274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..54
PX_SNX20 76..189 CDD:132833 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.