DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Rps6ka2

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_038934903.1 Gene:Rps6ka2 / 117269 RGDID:620676 Length:762 Species:Rattus norvegicus


Alignment Length:355 Identity:84/355 - (23%)
Similarity:142/355 - (40%) Gaps:117/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 ARYKVLQIL----QDRVMQVQCVTKSQQPAAIMKGVEKPAS--------HSLTQSIFLPQQVPYM 397
            :::::|::|    ..:|..|:.||.|.........|.|.|:        ..:.:.|......|::
  Rat    86 SQFELLKVLGQGSYGKVFLVRKVTGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFI 150

  Fly   398 VQLLAYFQSEQKIFLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSD 462
            |:|...||:|.|::|:|         |:|:.           |:||                   
  Rat   151 VKLHYAFQTEGKLYLIL---------DFLRG-----------GDLF------------------- 176

  Fly   463 SDVSDLVRSSQQLLKSVTNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHS 527
                  .|.|::::                                ..|:.::.:..|||:|:..
  Rat   177 ------TRLSKEVM--------------------------------FTEEDVKFYLAELALALDH 203

  Fly   528 LHGKGVILRDLHMGNILLGAKGQLLLTYF-YQNEGLTSDDNYVHKALNLEAVANHFVAPE----R 587
            |||.|:|.|||...||||..:|.:.:|.| ...|.:..|.........:|     ::|||    |
  Rat   204 LHGLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIE-----YMAPEVVNRR 263

  Fly   588 PLTFRSDWWSYGVVLYQLLLG-VPY-----KVTHPGQLDL-YGCVQYPSESLEISDHAKDLLEQL 645
            ..|..:||||:||:::::|.| :|:     |.|....|.. .|..|:      :|..|:.||..|
  Rat   264 GHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQF------LSAEAQSLLRAL 322

  Fly   646 LQLSPELRL-----DYDQLQAHPFFKGIDW 670
            .:.:|..||     ..::::.||||..|||
  Rat   323 FKRNPCNRLGAGVDGVEEIKRHPFFVTIDW 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357 79/348 (23%)
Rps6ka2XP_038934903.1 STKc_RSK_N 92..408 CDD:270734 83/349 (24%)
STKc_RSK3_C 440..732 CDD:271080
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.