DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx21

DIOPT Version :9

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_030102304.1 Gene:Snx21 / 101113 MGIID:1917729 Length:372 Species:Mus musculus


Alignment Length:243 Identity:55/243 - (22%)
Similarity:74/243 - (30%) Gaps:80/243 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PQALTCLV------------VWKRFHDVKRLHRELSRRHKSLQLPGKLPVPTDSTYFKR------ 85
            ||..|..|            :.:|:.|.:||||.|.|:.:.         |..:..|.|      
Mouse   147 PQLYTLAVMGPGPPDRQPAQISRRYSDFERLHRNLQRQFRG---------PMSAISFPRKRLRRN 202

  Fly    86 FDAAVIQRRKEYILQLLDFAAQHPALYKCSTFTQFF-----------------QE---------- 123
            |.|..|.||.....|.|......|.|.:......||                 :|          
Mouse   203 FTAETIARRSRAFEQFLGHLQAVPELRQAPDLQDFFVLPELRRAQSLTCTGLYREALALWANAWQ 267

  Fly   124 ------TPSPNGSPLKKLYVERSLRLQTEDNGCGSGGSETGTCA-GAIADICDKLDLPY-----D 176
                  |||....||..|........:.||.|      |...|: .|:..:.||...|:     :
Mouse   268 LQTQLGTPSGPDRPLLTLAGLAVCHQELEDPG------EARACSEKALQLLGDKRPHPFLAPFLE 326

  Fly   177 PHDAGGITPLDPR--CDKEQTNNESQAKETEIELETKQEPKTDVALTK 222
            .|     ..|..|  .||.|:..:.||.: |..|.:...|.....|.|
Mouse   327 AH-----VRLSWRLGLDKRQSEAQLQALQ-EAGLTSTPPPSLKELLIK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 27/135 (20%)
MIT_SNX15 241..315 CDD:239140
PKc_like 343..665 CDD:304357
Snx21XP_030102304.1 PX_domain 121..241 CDD:383026 26/102 (25%)
TPR_12 243..312 CDD:315987 13/74 (18%)
TPR repeat 243..267 CDD:276809 1/23 (4%)
TPR repeat 280..311 CDD:276809 9/36 (25%)
TPR repeat 325..352 CDD:276809 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.