DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and GRF13

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_565174.1 Gene:GRF13 / 844158 AraportID:AT1G78220 Length:245 Species:Arabidopsis thaliana


Alignment Length:246 Identity:115/246 - (46%)
Similarity:175/246 - (71%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67
            |||..:|.|||..||.|||:::::|:||..:|:||:.|||:||:..||||:.|:|.|.|:|:|||
plant     4 EREKLIYLAKLGCQAGRYDDVMKSMRKVCELDIELSEEERDLLTTGYKNVMEAKRVSLRVISSIE 68

  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSG-ESKVFYYKMKGDYHRY 131
            :.|::||.::.:::||..:..|:.|..::|:|||::::.||||..|:. ||.|.:.::||||.||
plant    69 KMEDSKGNDQNVKLIKGQQEMVKYEFFNVCNDILSLIDSHLIPSTTTNVESIVLFNRVKGDYFRY 133

  Fly   132 LAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAK 196
            :|||.:.::||:.|:|||.|||.|.::|.|.|.||:.:|||||||||:|.|||..|.:.||:|.|
plant   134 MAEFGSDAERKENADNSLDAYKVAMEMAENSLAPTNMVRLGLALNFSIFNYEIHKSIESACKLVK 198

  Fly   197 AAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247
            .|:|:||.|||.|.:...::|..|:::|:.||:.|||           |||
plant   199 KAYDEAITELDGLDKNICEESMYIIEMLKYNLSTWTS-----------GDG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 109/229 (48%)
GRF13NP_565174.1 14-3-3 7..235 CDD:278665 107/227 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.