DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and GF14 PHI

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001185138.1 Gene:GF14 PHI / 840403 AraportID:AT1G35160 Length:295 Species:Arabidopsis thaliana


Alignment Length:235 Identity:177/235 - (75%)
Similarity:201/235 - (85%) Gaps:2/235 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RENNVYKAKLAEQAERYDEMVEAMKKVA-SMDV-ELTVEERNLLSVAYKNVIGARRASWRIITSI 66
            ||..||.||||||||||:||||.|:||| ::|. ||||||||||||||||||||||||||||:||
plant    11 REEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEERNLLSVAYKNVIGARRASWRIISSI 75

  Fly    67 EQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRY 131
            |||||::|.::.:..|:.||.::|.||..||..||.:|:..|:|.:.:|:|||||.|||||||||
plant    76 EQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDSKVFYLKMKGDYHRY 140

  Fly   132 LAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAK 196
            ||||.||.:||||||::|.|||||.|||..:|.||||||||||||||||||||||||||||.|||
plant   141 LAEFKTGQERKDAAEHTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAK 205

  Fly   197 AAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQ 236
            .|||:||||||||.||||||||||||||||||||||||||
plant   206 QAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 172/230 (75%)
GF14 PHINP_001185138.1 14-3-3 11..245 CDD:295170 175/233 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 345 1.000 Domainoid score I232
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 364 1.000 Inparanoid score I579
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 1 1.000 - - otm2776
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - O PTHR18860
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.