DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and GRF3

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_568557.1 Gene:GRF3 / 833836 AraportID:AT5G38480 Length:255 Species:Arabidopsis thaliana


Alignment Length:253 Identity:194/253 - (76%)
Similarity:216/253 - (85%) Gaps:8/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTERENNVYKAKLAEQAERYDEMVEAMKKVA-SMDV-ELTVEERNLLSVAYKNVIGARRASWRII 63
            |:.||.|||.||||||||||:||||.|:||| ::|| ||:|||||||||||||||||||||||||
plant     1 MSTREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELSVEERNLLSVAYKNVIGARRASWRII 65

  Fly    64 TSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDY 128
            :|||||||:||.|:.:.:||.|||::|.||..||..||||||.||||.|:..||||||.||||||
plant    66 SSIEQKEESKGNEDHVAIIKDYRGKIESELSKICDGILNVLEAHLIPSASPAESKVFYLKMKGDY 130

  Fly   129 HRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACR 193
            |||||||..|::||:|||::|:|||:|||||..:|.||||||||||||||||||||||||||||.
plant   131 HRYLAEFKAGAERKEAAESTLVAYKSASDIATAELAPTHPIRLGLALNFSVFYYEILNSPDRACS 195

  Fly   194 LAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPKE 251
            |||.||||||||||||.|||||||||||||||||||||||||..|     ||| |.||
plant   196 LAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDE-----AGD-EIKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 182/230 (79%)
GRF3NP_568557.1 14-3-3 4..240 CDD:413191 186/235 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 345 1.000 Domainoid score I232
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100743
Inparanoid 1 1.050 364 1.000 Inparanoid score I579
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 1 1.000 - - otm2776
orthoMCL 1 0.900 - - OOG6_100283
Panther 1 1.100 - - O PTHR18860
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.930

Return to query results.
Submit another query.