DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 14-3-3epsilon and GRF5

DIOPT Version :9

Sequence 1:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001331015.1 Gene:GRF5 / 831462 AraportID:AT5G16050 Length:268 Species:Arabidopsis thaliana


Alignment Length:262 Identity:186/262 - (70%)
Similarity:216/262 - (82%) Gaps:9/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TERENNVYKAKLAEQAERYDEMVEAMKKVASM--DVELTVEERNLLSVAYKNVIGARRASWRIIT 64
            :.||.|||.||||||||||:||||.|:|||..  ..||||||||||||||||||||||||||||:
plant     5 SSREENVYLAKLAEQAERYEEMVEFMEKVAKTVETEELTVEERNLLSVAYKNVIGARRASWRIIS 69

  Fly    65 SIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYH 129
            ||||||:::|..:.:.:||.|||::|.||..||..|||:||.||||.|:..||||||.|||||||
plant    70 SIEQKEDSRGNSDHVSIIKDYRGKIETELSKICDGILNLLEAHLIPAASLAESKVFYLKMKGDYH 134

  Fly   130 RYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRL 194
            ||||||.||::||:|||::|:|||:|.|||:.||.|||||||||||||||||||||||.||||.|
plant   135 RYLAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSSDRACSL 199

  Fly   195 AKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG--EPKEQIQDVE 257
            ||.|||:||:|||||.||||||||||||||||||||||||:..|     |||.  |..:::|.|:
plant   200 AKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLNDE-----AGDDIKEAPKEVQKVD 259

  Fly   258 DQ 259
            :|
plant   260 EQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 175/230 (76%)
GRF5NP_001331015.1 14_3_3 7..250 CDD:128412 182/247 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 345 1.000 Domainoid score I232
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100743
Inparanoid 1 1.050 364 1.000 Inparanoid score I579
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 1 1.000 - - otm2776
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1212.030

Return to query results.
Submit another query.